missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WFDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WFDC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WFDC1 Polyclonal specifically detects WFDC1 in Human samples. It is validated for Western Blot.Specifications
| WFDC1 | |
| Polyclonal | |
| Rabbit | |
| Q9HC57 | |
| 58189 | |
| Synthetic peptides corresponding to WFDC1 (WAP four-disulfide core domain 1) The peptide sequence was selected from the middle region of WFDC1)(50ug). Peptide sequence VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ps20 growth inhibitor, PS20Prostate stromal protein ps20, WAP four-disulfide core domain 1, WAP four-disulfide core domain 1 homolog, WAP four-disulfide core domain protein 1 | |
| WFDC1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title