Wee1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33344-20ul

Product Code. 30228315

Description

Wee1 Monoclonal antibody specifically detects Wee1 in Mouse samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)

Specifications

• Antigen: Wee1
• Classification: Monoclonal
• Dilution: ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DKFZp686I18166, EC 2.7.10.2, FLJ16446, WEE1 homolog (S. pombe), wee1+ (S. pombe) homolog, WEE1+ homolog, WEE1A, Wee1A kinase, WEE1hu, wee1-like protein kinase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Wee1 (NP_003381.1).,, Sequence:, MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Phospho Specific, Stem Cell Markers
• Gene ID (Entrez): 7465
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified