missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Wee1 Polyclonal antibody specifically detects Wee1 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Wee1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | DKFZp686I18166, EC 2.7.10.2, FLJ16446, WEE1 homolog (S. pombe), wee1+ (S. pombe) homolog, WEE1+ homolog, WEE1A, Wee1A kinase, WEE1hu, wee1-like protein kinase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WEE1 (NP_003381.1). EAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADI |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?