missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ wdyhv1 Recombinant Protein Antigen

Product Code. 18227083 Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 18227083

Brand: Novus Biologicals™ NBP258578PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human wdyhv1. Source: E.coli Amino Acid Sequence: RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS The wdyhv1 Recombinant Protein Antigen is derived from E. coli. The wdyhv1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 55093
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name wdyhv1 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias C8orf32, chromosome 8 open reading frame 32, EC 3.5.1.-, FLJ10204, nt(Q)-amidase, NTAQ1, N-terminal Gln amidase, Protein NH2-terminal glutamine deamidase, protein N-terminal glutamine amidohydrolase, WDYHV motif containing 1, WDYHV motif-containing protei
Gene Symbol WDYHV1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51873. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.