missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35262-100ul
This item is not returnable.
View return policy
Description
WDR9 Polyclonal antibody specifically detects WDR9 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| WDR9 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:3000, ELISA | |
| bromodomain and WD repeat domain containing 1, bromodomain and WD repeat-containing protein 1, C21orf107, chromosome 21 open reading frame 107, FLJ11315, FLJ43918, N143, transcriptional unit N143, WD repeat domain 9, WD repeat protein WDR9-form2, WD repeat-containing protein 9, WDR9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WDR9 (NP_001007247.1).,, Sequence:, MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI | |
| 100 μL | |
| Primary | |
| Human, Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 54014 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction