missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR83OS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£393.00
Specifications
| Antigen | C19orf56 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR83OS Polyclonal specifically detects WDR83OS in Human samples. It is validated for Western Blot.Specifications
| C19orf56 | |
| Polyclonal | |
| Rabbit | |
| Q9Y284 | |
| 51398 | |
| Synthetic peptides corresponding to C19ORF56 The peptide sequence was selected from the N terminal of C19ORF56. Peptide sequence STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C19orf56, chromosome 19 open reading frame 56, hypothetical protein LOC51398, PTD008, WD repeat domain 83 opposite strand | |
| WDR83OS | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title