missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR79 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | WDR79 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18241224
|
Novus Biologicals
NBP2-56099 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626226
|
Novus Biologicals
NBP2-56099-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
WDR79 Polyclonal specifically detects WDR79 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| WDR79 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55135 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ10385, TCAB1WDR79telomerase Cajal body protein 1, WD repeat containing, antisense to TP53, WD repeat domain 79, WD repeat-containing protein 79, WD40 protein Wrap53, WD40 repeat-containing protein encoding RNA antisense to p53, WD-encoding RNA antisense to p53 | |
| WRAP53 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title