missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR68 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WDR68 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR68 Polyclonal specifically detects WDR68 in Mouse samples. It is validated for Western Blot.Specifications
| WDR68 | |
| Polyclonal | |
| Rabbit | |
| P61963 | |
| 10238 | |
| Synthetic peptides corresponding to the N terminal of Dcaf7. Immunizing peptide sequence SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein | |
| DCAF7 | |
| IgG | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title