missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR63 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WDR63 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR63 Polyclonal specifically detects WDR63 in Human samples. It is validated for Western Blot.Specifications
| WDR63 | |
| Polyclonal | |
| Rabbit | |
| Q8IWG1 | |
| 126820 | |
| Synthetic peptides corresponding to WDR63(WD repeat domain 63) The peptide sequence was selected from the middle region of WDR63. Peptide sequence EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ30067, NYD-SP29, RP11-507C22.2, Testis development protein NYD-SP29, testis development protein NYD-SP29 (NYD-SP29), WD repeat domain 63, WD repeat-containing protein 63 | |
| WDR63 | |
| IgG | |
| 103 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title