missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WDR6 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR6 Polyclonal specifically detects WDR6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| WDR6 | |
| Polyclonal | |
| Rabbit | |
| Q6AZD6 | |
| 11180 | |
| Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6. Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| FLJ10218, FLJ52552, FLJ56107, MGC126756, MGC142027, WD repeat domain 6, WD repeat-containing protein 6 | |
| WDR6 | |
| IgG | |
| 53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title