missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR57 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | WDR57 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18414581
|
Novus Biologicals
NBP1-92585-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18014487
|
Novus Biologicals
NBP1-92585 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
WDR57 Polyclonal specifically detects WDR57 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| WDR57 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9410 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 38 kDa-splicing factor, HPRP8BP, Prp8-binding protein, PRP8BP40K, PRPF8BPFLJ41108, RP11-490K7.3, SFP38, small nuclear ribonucleoprotein 40kDa (U5), SPF38MGC1910, U5 small nuclear ribonucleoprotein 40 kDa protein, U5 snRNP 40 kDa protein, U5 snRNP-specific 40 kDa protein, U5 snRNP-specific 40 kDa protein (hPrp8-binding), U5-40K, U5-40kD protein, WD repeat domain 57 (U5 snRNP specific), WD repeat-containing protein 57, WDR57 | |
| SNRNP40 | |
| IgG | |
| Affinity Purified | |
| Specificity of human WDR57 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title