missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR51B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WDR51B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR51B Polyclonal specifically detects WDR51B in Human samples. It is validated for Western Blot.Specifications
| WDR51B | |
| Polyclonal | |
| Rabbit | |
| Q8TC44 | |
| 282809 | |
| Synthetic peptides corresponding to WDR51B(WD repeat domain 51B) The peptide sequence was selected from the N terminal of WDR51B. Peptide sequence GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14923, FLJ41111, PIX1, POC1 centriolar protein homolog B, POC1 centriolar protein homolog B (Chlamydomonas), TUWD12, WD repeat domain 51B, WD repeat-containing protein 51B, WDR51B | |
| POC1B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title