missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £489.00
Specifications
| Antigen | WDR5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18056404
|
Novus Biologicals
NBP2-55518 |
100 μL |
£489.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681559
|
Novus Biologicals
NBP2-55518-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
WDR5 Polyclonal specifically detects WDR5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| WDR5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, SWD3, Set1c WD40 repeat protein, homolog, WD repeat domain 5, WD repeat-containing protein 5, WD-repeat protein 5 | |
| WDR5 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 11091 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title