missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WBP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WBP4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WBP4 Polyclonal specifically detects WBP4 in Human samples. It is validated for Western Blot.Specifications
| WBP4 | |
| Polyclonal | |
| Rabbit | |
| NP_009118 | |
| 11193 | |
| Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) | |
| WBP4 | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title