missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WASF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | WASF2 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18617825
|
Novus Biologicals
NBP2-37912-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18739023
|
Novus Biologicals
NBP2-37912 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
WASF2 Polyclonal specifically detects WASF2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| WASF2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9Y6W5 | |
| 10163 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IMD2, Protein WAVE-2, SCAR2suppressor of cyclic-AMP receptor (WASP-family), Verprolin homology domain-containing protein 2, WAS protein family, member 2, WASP family Verprolin-homologous protein 2, WAVE2dJ393P12.2, wiskWASP family protein member 2 | |
| WASF2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title