Novus Biologicals™ WARS2 Recombinant Protein Antigen

Product Code.	Quantity	unitSize
18258491	100 μL	100µL

Product Code. 18258491 Supplier Novus Biologicals™ Supplier No. NBP257679PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WARS2. Source: E.coli Amino Acid Sequence: MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA The WARS2 Recombinant Protein Antigen is derived from E. coli. The WARS2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 10352
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: WARS2 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: (Mt)TrpRS, EC 6.1.1, EC 6.1.1.2, TrpRStryptophan-tRNA ligase, tryptophan tRNA ligase 2, mitochondrial, Tryptophan--tRNA ligase, tryptophanyl tRNA synthetase 2, mitochondrial, tryptophanyl-tRNA synthetase, mitochondrial
• Gene Symbol: WARS2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53170. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.