missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WARP/VWA1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10148-100UL
This item is not returnable.
View return policy
Description
WARP/VWA1 Polyclonal specifically detects WARP/VWA1 in Rat samples. It is validated for Western Blot.
Specifications
| WARP/VWA1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| DKFZp761O051, von Willebrand factor A domain containing 1, von Willebrand factor A domain-containing protein 1, von Willebrand factor A domain-related protein, WARP | |
| The immunogen is a synthetic peptide directed towards the N terminal region of rat WARP/VWA1 (NP_001013960 ). Peptide sequence LALAQSGIERGPTASAPQGDLLFLLDSSASVSHYEFSRVREFVGQLVATMP | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 64856 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction