VSIG2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10182-100UL

Product Code. 18365106

Description

VSIG2 Polyclonal specifically detects VSIG2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: VSIG2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 2210413P10Rik, Cortical thymocyte-like protein, CTHCTXLcortical thymocyte receptor (X. laevis CTX) like, CT-like protein, V-set and immunoglobulin domain containing 2, V-set and immunoglobulin domain-containing protein 2
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse VSIG2 (NP_065264.2). Peptide sequence DLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23584
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.