missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPS4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | VPS4A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
VPS4A Polyclonal specifically detects VPS4A in Human samples. It is validated for Western Blot.Specifications
| VPS4A | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| FLJ22197, hVPS4, Protein SKD2, SKD1, SKD1A, SKD2, vacuolar protein sorting 4 homolog A (S. cerevisiae), vacuolar protein sorting 4A (yeast homolog), vacuolar protein sorting factor 4A, vacuolar protein sorting-associated protein 4A, vacuolar sorting protein 4, VPS4-1SKD1-homolog, VPS4vacuolar protein sorting 4A (yeast) | |
| VPS4A | |
| IgG | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UN37 | |
| 27183 | |
| Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title