missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPREB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | VPREB1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
VPREB1 Polyclonal specifically detects VPREB1 in Human samples. It is validated for Western Blot.Specifications
| VPREB1 | |
| Polyclonal | |
| Rabbit | |
| CD179 antigen-like family member A, CD179a, IGI, immunoglobulin iota chain, pre-B lymphocyte 1 | |
| VPREB1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 7441 | |
| Synthetic peptides corresponding to VPREB1(pre-B lymphocyte gene 1) The peptide sequence was selected from the middle region of VPREB1. Peptide sequence TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title