missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Vomeronasal 1 receptor 54 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Vomeronasal 1 receptor 54 Polyclonal specifically detects Vomeronasal 1 receptor 54 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Vomeronasal 1 receptor 54 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | V1, V1ra9, VN7 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse Vomeronasal 1 receptor 54 (NP_444454.1). Peptide sequence NKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?