missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VMAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68952
This item is not returnable.
View return policy
Description
VMAT2 Polyclonal antibody specifically detects VMAT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| VMAT2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| MGC120477, monoamine neurotransmitter transporter, Monoamine transporter, solute carrier family 18 (vesicular monoamine), member 2, Solute carrier family 18 member 2, SVAT, SVMTMGC120478, synaptic vesicular amine transporter, VAT2MGC26538, vesicle monoamine transporter type 2, vesicle monoamine/H+ antiporter, Vesicular amine transporter 2, VMAT2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD | |
| 100 μg | |
| Neuroscience | |
| 6571 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction