VMAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68952-25ul

Product Code. 18687986

Description

VMAT2 Polyclonal antibody specifically detects VMAT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: VMAT2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: MGC120477, monoamine neurotransmitter transporter, Monoamine transporter, solute carrier family 18 (vesicular monoamine), member 2, Solute carrier family 18 member 2, SVAT, SVMTMGC120478, synaptic vesicular amine transporter, VAT2MGC26538, vesicle monoamine transporter type 2, vesicle monoamine/H+ antiporter, Vesicular amine transporter 2, VMAT2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6571
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified