missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VIPR1/VPAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

VIPR1/VPAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18389534 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389534 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18389534 Supplier Novus Biologicals Supplier No. NBP310042100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

VIPR1/VPAC1 Polyclonal specifically detects VIPR1/VPAC1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen VIPR1/VPAC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ41949, HVR1, II, PACAP type II receptor, type II, vasoactive intestinal peptide receptor 1, vasoactive intestinal polypeptide receptor 1, VIP receptor, type I
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of Human VIPR1/VPAC1 (NP_001238811.1). Peptide sequence WRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, GPCR, Neuroscience, Neurotransmission, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7433
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.