Invitrogen™ Human Regucalcin (aa 16-88) Control Fragment Recombinant Protein

Product Code. 30212379

Brand: Invitrogen™ RP108789

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein.

Specifications

• Accession Number: Q15493
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9104
• Name: Human Regucalcin (aa 16-88) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI265316; epididymis secretory protein Li 41; gluconolactonase; GNL; HEL-S-41; RC; Reguc; regucalcin; regucalcin (senescence marker protein-30); Rgn; Senescence marker protein 30; Smp30; SMP-30
• Common Name: Regucalcin
• Gene Symbol: Rgn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining