Invitrogen™ Human OLFML2B (aa 302-375) Control Fragment Recombinant Protein

Product Code. 30211639

Brand: Invitrogen™ RP105241

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66528 (PA5-66528. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an olfactomedin domain-containing protein. Most olfactomedin domain-containing proteins are secreted glycoproteins.

Specifications

• Accession Number: Q68BL8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25903
• Name: Human OLFML2B (aa 302-375) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110018N05Rik; 4832415H08Rik; AI467542; olfactomedin like 2 B; olfactomedin-like 2 B; olfactomedin-like protein 2 B; Olfml2b; Photomedin-2
• Common Name: OLFML2B
• Gene Symbol: OLFML2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining