Invitrogen™ Human KIF15 (aa 765-858) Control Fragment Recombinant Protein

Product Code. 30211283

Brand: Invitrogen™ RP96411

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57304 (PA5-57304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly. Target protein's mouse homolog associates with microtubulew and appears to play a role in mitosis in fibroblasts and in migration in developing neurons.

Specifications

• Accession Number: Q9NS87
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56992
• Name: Human KIF15 (aa 765-858) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110023M17Rik; 3930402I10Rik; b2b1117.1 aClo; b2b1117.1 Clo; D330038N01; hKLP2; KIF15; kinesin 15; kinesin family member 15; kinesin-like 7; kinesin-like protein 2; Kinesin-like protein 7; kinesin-like protein KIF15; Klp2; Knsl7; N-10 kinesin; NY-BR-62; serologically defined breast cancer antigen NY-BR-62
• Common Name: KIF15
• Gene Symbol: KIF15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIDWTKQQEELLSQLNVLEKQLQETQTKNDFLKSEVHDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHMHVQLQLDNLRLENEKLLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining