Invitrogen™ Human LFG (aa 1-45) Control Fragment Recombinant Protein

Product Code. 30209469

Brand: Invitrogen™ RP92046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82634 (PA5-82634. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LFG, a seven transmembrane spanning protein, is a recently identified member of a family whose members can inhibit apoptotic cell death induced by Fas receptor. LFG is a human homolog of rat NMP35 and consists of a conserved transmembrane domain and a small cytoplasmic domain. Reports have shown that LFG protects the cell from Fas-mediated neuronal cell death in a novel way. LFG binds to Fas receptor but doesn't have any effect in reducing Fas expression or decreasing the ability of FADD binding to the receptor. Furthermore, LFG doesn't protect the cells from TNF-alpha mediated cell death process. Although LFG is ubiquitously expressed, Northern blot analysis detected an increased expression in hippocampus and other neural tissues, suggesting a protective role in neurodegenerative diseases.

Specifications

• Accession Number: Q9BWQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23017
• Name: Human LFG (aa 1-45) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900002L20Rik; FAIM2; Fas apoptotic inhibitory molecule 2; fas apoptotic inhibitory molecule 2; protein lifeguard 2; Kiaa0950; Lfg; LFG2; lifeguard; neural membrane protein 35; NGP35; NMP25; Nmp35; protein lifeguard; protein lifeguard 2; TMBIM2; transmembrane BAX inhibitor motif-containing protein 2
• Common Name: LFG
• Gene Symbol: FAIM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining