Invitrogen™ Human ZNF179 (aa 427-540) Control Fragment Recombinant Protein

Product Code. 30208970

Brand: Invitrogen™ RP90951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53402 (PA5-53402. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of this protein remains unknown. This gene encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Specifications

• Accession Number: Q9ULX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7732
• Name: Human ZNF179 (aa 427-540) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI854096; Bfb; bfp; Brain finger protein; LOW QUALITY PROTEIN: RING finger protein 112; neurolastin; R75574; RING finger protein 112; Rnf112; Zfp179; zinc finger protein 179; ZNF179
• Common Name: ZNF179
• Gene Symbol: RNF112
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining