Invitrogen™ Human DDX52 (aa 15-99) Control Fragment Recombinant Protein

Product Code. 30208707

Brand: Invitrogen™ RP93272

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63257 (PA5-63257. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.

Specifications

• Accession Number: Q9Y2R4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11056
• Name: Human DDX52 (aa 15-99) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700029C06Rik; ATP-dependent RNA helicase ROK1-like; ATP-dependent, RNA helicase; DDX52; DEAD (Asp-Glu-Ala-Asp) box polypeptide 52; DEAD box protein 52; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 52; DEAD-box helicase 52; HUSSY19; HUSSY-19; probable ATP-dependent RNA helicase DDX52; Rok1; rROK1L
• Common Name: DDX52
• Gene Symbol: DDX52
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining