Invitrogen™ Human CHST13 (aa 35-111) Control Fragment Recombinant Protein

Product Code. 30207359

Brand: Invitrogen™ RP109145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140122 (PA5-140122. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the Golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1, 4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices.

Specifications

• Accession Number: Q8NET6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 166012
• Name: Human CHST13 (aa 35-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110067M19Rik; C4ST3; C4ST-3; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; Chondroitin 4-O-sulfotransferase 3; chondroitin 4-sulfotransferase 3; CHST13; DcR3; Decoy receptor 3; M68; RGD1562825
• Common Name: CHST13
• Gene Symbol: CHST13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining