Invitrogen™ Human UBAP2L (aa 1018-1088) Control Fragment Recombinant Protein

Product Code. 30206967

Brand: Invitrogen™ RP94295

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57141 (PA5-57141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NICE4, also known as UBAP2L (Ubiquitin-associated protein 2-like) orKIAA0144, is a 1,087 amino acid protein that is ubiquitously expressed. Phosphorylated upon DNA damage, NICE4 contains one UBA domain and is expressed as 4 isoforms produced by alternative splicing events. The gene that encodes NICE4 maps to human chromosome 1. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes Lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1.

Specifications

• Accession Number: Q14157
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9898
• Name: Human UBAP2L (aa 1018-1088) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110083O19Rik; 4932431F02Rik; A430103N23Rik; Atp8b2; Atpase, class I, type 8 B, member 2; C77168; EP1; KIAA0144; mKIAA0144; NICE4; NICE-4; Nice-4 protein homolog; Protein NICE-4; Ubap2l; ubiquitin associated protein 2 like; ubiquitin associated protein 2-like; ubiquitin-associated protein 2-like
• Common Name: UBAP2L
• Gene Symbol: UBAP2L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining