Invitrogen™ Human PARL (aa 122-167) Control Fragment Recombinant Protein

Product Code. 30205660

Brand: Invitrogen™ RP91183

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82683 (PA5-82683. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9H300
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55486
• Name: Human PARL (aa 122-167) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D16Ertd607e; Mitochondrial intramembrane cleaving protease PARL; mitochondrial intramembrane-cleaving protease PARL; Parl; parl {ECO:0000250; Pbeta; P-beta; presenilin associated rhomboid like; presenilin associated, rhomboid-like; presenilin associated, rhomboid-like isoform 1 preproprotein; presenilin associated, rhomboid-like preproprotein; presenilins-associated rhomboid-like protein, mitochondrial; PRO2207; Psarl; PSARL1; PSENIP2; RHBDS1; rhomboid 7 homolog 1; UniProtKB:Q9H300}
• Common Name: PARL
• Gene Symbol: PARL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining