Invitrogen™ Human COL27A1 (aa 1756-1860) Control Fragment Recombinant Protein

Product Code. 30204327

Brand: Invitrogen™ RP93113

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61746 (PA5-61746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the fibrillar collagen family, and plays a role during the calcification of cartilage and the transition of cartilage to bone. The encoded protein product is a preproprotein. It includes an N-terminal signal peptide, which is followed by an N-terminal propetide, mature peptide and a C-terminal propeptide. The N-terminal propeptide contains thrombospondin N-terminal-like and laminin G-like domains. The mature peptide is a major triple-helical region. The C-terminal propeptide, also known as COLFI domain, plays crucial roles in tissue growth and repair. Mutations in this gene cause Steel syndrome. Alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been determined.

Specifications

• Accession Number: Q8IZC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85301
• Name: Human COL27A1 (aa 1756-1860) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730512J02Rik; AI449266; Col27a1; Collagen alpha-1(XXVII) chain; collagen type XXVII alpha 1; collagen type XXVII alpha 1 chain; collagen type XXVII proalpha 1 chain; collagen, type XXVII, alpha 1; KIAA1870; LOW QUALITY PROTEIN: collagen alpha-1(XXVII) chain; mKIAA1870; procollagen, type XXVII, alpha 1; STLS
• Common Name: COL27A1
• Gene Symbol: COL27A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSEVTQHITIHCLNMTVWQEGTGQTPAKQAVRFRAWNGQIFEAGGQFRPEVSMDGCKVQDGRWHQTLFTFRTQDPQQLPIISVDNLPPASSGKQYRLEVGPACFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining