Invitrogen™ Human Serglycin (aa 2-125) Control Fragment Recombinant Protein

Product Code. 30202943

Brand: Invitrogen™ RP93682

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51452 (PA5-51452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.

Specifications

• Accession Number: P10124
• Concentration: 1.10 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5552
• Name: Human Serglycin (aa 2-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: gp600; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; hematopoietic proteoglycan core protein; Mastocytoma proteoglycan core protein; p.PG; Platelet proteoglycan core protein; PPG; Prg; Prg1; proteoglycan 1, secretory granule; proteoglycan protein core for mast cell secretory granule; proteoglycan, secretory granule; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; Serglycin; serglycin proteoglycan; Sgc; Srgn
• Common Name: Serglycin
• Gene Symbol: SRGN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining