Invitrogen™ Human KBTBD3 (aa 271-376) Control Fragment Recombinant Protein

Product Code. 30201624

Brand: Invitrogen™ RP97514

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61495 (PA5-61495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The BTB (Broad-Complex, Tram track and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KBTBD3 (kelch repeat and BTB domain-containing protein 3), also known as BKLHD3, is a 608 amino acid protein that contains one BACK (BTB/Kelch associated) domain, one BTB (POZ) domain and five kelch repeats. The gene encoding KBTBD3 maps to human chromosome 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11.

Especificaciones

• Accession Number: Q8NAB2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 143879
• Name: Human KBTBD3 (aa 271-376) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2200003A07Rik; Bklhd3; BTB and kelch domain containing 3; BTB and kelch domain-containing protein 3; Kbtbd3; kelch repeat and BTB (POZ) domain containing 3; kelch repeat and BTB domain containing 3; kelch repeat and BTB domain-containing protein 3
• Common Name: KBTBD3
• Gene Symbol: KBTBD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IMDAIKCVQGSGGLFPDARPSTTEKYIFIHKTEENGENQYTFCYNIKSDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRLHIAESYHDATDQTWCY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining