Invitrogen™ Human ZZZ3 (aa 706-786) Control Fragment Recombinant Protein

Product Code. 30198495

Brand: Invitrogen™ RP103877

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64266 (PA5-64266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Specifications

• Accession Number: Q8IYH5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26009
• Name: Human ZZZ3 (aa 706-786) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110065C23Rik; 6430567E01Rik; AA408566; AI481057; ATAC component 1 homolog; ATAC1; AW556059; DKFZP564I052; R75514; RGD1565468; zinc finger ZZ-type containing 3; zinc finger, ZZ domain containing 3; zinc finger, ZZ-type containing 3; ZZ-type zinc finger-containing protein 3; Zzz3
• Common Name: ZZZ3
• Gene Symbol: ZZZ3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining