missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198253

Invitrogen™ Human C12orf11 (aa 609-681) Control Fragment Recombinant Protein

Product Code. 30198253
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198253

Brand: Invitrogen™ RP109314

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Crucial regulator of the mitotic cell cycle and development. At prophase, required for dynein anchoring to the nuclear envelope important for proper centrosome-nucleus coupling. At G2/M phase, may be required for proper spindle formation and execution of cytokinesis. Probable component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing (PubMed:23904267). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NVM9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55726
Name Human C12orf11 (aa 609-681) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933424B01Rik; ASUN; asunder spermatogenesis regulator; asunder, spermatogenesis regulator; asunder, spermatogenesis regulator homolog (Drosphila); C12orf11; C27H12orf11; C5H12orf11; Cell cycle regulator Mat89Bb homolog; Cell cycle regulator Mat89Bb-like protein-like protein; fi39e09; GCT1; Germ cell tumor 1; integrator complex subunit 13; integrator complex subunit 13; protein asunder homolog; IntS13; likely orthologue of H. sapiens chromosome 12 open reading frame 11 (C12orf11); Mat89Bb; NET48; Protein asunder homolog; sarcoma antigen NY-SAR-95; Similar to hypothetical protein FLJ10637; similar to Protein C12orf11 (Sarcoma antigen NY-SAR-95); SPATA30; spermatogenesis associated 30; spermatogenesis-associated protein 30; wu:fi39e09; zgc:55466
Common Name C12orf11
Gene Symbol INTS13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.