Kir2.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-87709-25ul

Product Code. 18461882

Description

Kir2.1 Polyclonal specifically detects Kir2.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kir2.1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Cardiac inward rectifier potassium channel, HHBIRK1, HHIRK1, hIRK1, Inward rectifier K(+) channel Kir2.1, inward rectifier K+ channel KIR2.1, inward rectifier potassium channel 2, IRK-1, IRK1LQT7, Kir2.1, Potassium channel, inwardly rectifying subfamily J member 2, potassium inwardly-rectifying channel, subfamily J, member 2, SQT3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3759
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNJ2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only