COX7A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10698-100UL

Product Code. 18368725

Description

COX7A2 Polyclonal specifically detects COX7A2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COX7A2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: COX7ALmitochondrial, cytochrome c oxidase polypeptide VIIa-liver/heart, cytochrome c oxidase subunit 7A2, mitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 (liver), hepatic cytochrome-c oxidase chain VIIa, MGC118951, MGC118952, MGC126875, MGC126877
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COX7A2 (NP_001856). Peptide sequence LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1347
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.