RECK Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10279-100UL

Product Code. 18326984

Description

RECK Polyclonal specifically detects RECK in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: RECK
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RECK (NP_057887.2). Peptide sequence MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 8434
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified