missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHX30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85270
This item is not returnable.
View return policy
Description
DHX30 Polyclonal specifically detects DHX30 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| DHX30 | |
| Polyclonal | |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ATP-dependent RNA helicase DHX30, DDX30, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 30, DEAH (Asp-Glu-Ala-His) box polypeptide 30, DEAH box protein 30, EC 3.6.1, EC 3.6.4.13, FLJ11214, KIAA0890RETCOR, putative ATP-dependent RNA helicase DHX30, retina co-repressor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 22907 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DHX30 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPA | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction