MTMR15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56425

Product Code. 18248022

Description

MTMR15 Polyclonal specifically detects MTMR15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MTMR15
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp451H236, EC 3.1.21.-, EC 3.1.4.1, FANCD2/FANCI-associated nuclease 1DKFZp686K16147, fanconi anemia associated nuclease 1, fanconi-associated nuclease 1, KIAA1018coiled-coil domain-containing protein MTMR15, MTMR15, myotubularin related protein 15, Myotubularin-related protein 15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22909
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FAN1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only