Abnova™ Human PRR4 Partial ORF (NP_009175.1, 17 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16124016

Brand: Abnova™ H00011272Q01.10ug

Description

Used for AP, Array, ELISA, WB-Re

Lacrimal proline rich protein is a member of the proline-rich protein family which lacks a conserved repetitive domain. It may have a role in protective functions in the eye. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Sequence: QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEAS

Specifications

• Accession Number: NP_009175.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 11272
• Molecular Weight (g/mol): 36.74kDa
• Name: PRR4 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEAS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp779L1763/LPRP/PROL4
• Common Name: PRR4
• Gene Symbol: PRR4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid