missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VIAAT/SLC32A1/VGAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | VIAAT/SLC32A1/VGAT |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18416111
|
Novus Biologicals
NBP2-34117-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18134055
|
Novus Biologicals
NBP2-34117 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
VIAAT/SLC32A1/VGAT Polyclonal specifically detects VIAAT/SLC32A1/VGAT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| VIAAT/SLC32A1/VGAT | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| bA122O1.1, hVIAAT, solute carrier family 32 (GABA vesicular transporter), member 1, Solute carrier family 32 member 1, Vesicular GABA transporter, vesicular inhibitory amino acid transporter, VGATGABA and glycine transporter, VIAAT | |
| SLC32A1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9H598 | |
| 140679 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel