missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VGLUT2 Antibody (CL2952), Novus Biologicals™
Mouse Monoclonal Antibody
£292.00 - £452.00
Specifications
| Antigen | VGLUT2 |
|---|---|
| Clone | CL2952 |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -Reported in scientific publication (PMID: 32337749) |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18656055
|
Novus Biologicals
NBP2-46641-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18614336
|
Novus Biologicals
NBP2-46641 |
0.1 mL |
£452.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VGLUT2 Monoclonal antibody specifically detects VGLUT2 in Human, Mouse, Rat, Macaque samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)Specifications
| VGLUT2 | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -Reported in scientific publication (PMID: 32337749) | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat, Macaque | |
| Q9P2U8 | |
| 57084 | |
| IgG1 | |
| Protein A purified |
| CL2952 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| Mouse | |
| Neuroscience | |
| PBS (pH 7.2), 40% Glycerol | |
| differentiation-associated BNPI, differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, differentiation-associated Na-dependent inorganic phosphate cotransporter, DNPI, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6, solute carrier family 17 member 6, vesicular glutamate transporter 2, VGLUT2 | |
| Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title