VAT1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93463-0.1ml

Product Code. 18653551

Description

VAT1 Polyclonal antibody specifically detects VAT1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-Out

Specifications

• Antigen: VAT1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Knockout Validated
• Gene Alias: FLJ20230, membrane protein of cholinergic synaptic vesicles, synaptic vesicle membrane protein VAT-1 homolog, VATI, vesicle amine transport protein 1 homolog (T. californica)
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2). GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
• Quantity: 0.1 mL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 10493
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence, Gene Knock-Out
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified