VASA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13907-25ul

Product Code. 18443112

Description

VASA Polyclonal antibody specifically detects VASA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: VASA
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 4, DEAD box protein 4, EC 3.6.1, EC 3.6.4.13, MGC111074, probable ATP-dependent RNA helicase DDX4, Vasa homolog, VASADEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54514
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG