missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
VAC14 Polyclonal antibody specifically detects VAC14 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | VAC14 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ArPIKfyve, FLJ10305, FLJ36622, MGC149816, protein VAC14 homolog, Tax1 (human T-cell leukemia virus type I) binding protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 2, Tax1-binding protein 2, TAX1BP2FLJ46582, TRXMGC149815, Vac14 homolog (S. cerevisiae) |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?