missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18365799

VAC14 Antibody (3B2), Novus Biologicals™

Product Code. 18365799 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365799 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365799 Supplier Novus Biologicals Supplier No. H00055697M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

VAC14 Monoclonal antibody specifically detects VAC14 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen VAC14
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3B2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_060522
Gene Alias ArPIKfyve, FLJ10305, FLJ36622, MGC149816, protein VAC14 homolog, Tax1 (human T-cell leukemia virus type I) binding protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 2, Tax1-binding protein 2, TAX1BP2FLJ46582, TRXMGC149815, Vac14 homolog (S. cerevisiae)
Host Species Mouse
Immunogen VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55697
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.